PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00089.65
Common NameAMTR_s00089p00116340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family WRKY
Protein Properties Length: 696aa    MW: 75779.1 Da    PI: 6.655
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00089.65genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.55.7e-33199256260
                                              --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                                     WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                                              +DgynWrKYGqK+vkgse+prsYY+Ct+++C+vkkkvers+ d++++ei+Y+g+Hnh+k
  evm_27.model.AmTr_v1.0_scaffold00089.65 199 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCQVKKKVERSH-DGQITEIIYKGSHNHPK 256
                                              7****************************************.***************85 PP

2WRKY102.62.2e-32414472159
                                              ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                     WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                              ldDgy+WrKYGqK+vkg+++prsYY+Ct agC+v+k+ver+++d k v++tYeg+Hnh+
  evm_27.model.AmTr_v1.0_scaffold00089.65 414 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNAGCSVRKHVERASHDVKSVITTYEGKHNHD 472
                                              59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.7E-30189257IPR003657WRKY domain
SuperFamilySSF1182902.88E-26196257IPR003657WRKY domain
SMARTSM007745.5E-37198256IPR003657WRKY domain
PfamPF031061.3E-25199255IPR003657WRKY domain
PROSITE profilePS5081123.973199257IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-36399474IPR003657WRKY domain
SuperFamilySSF1182902.22E-28406474IPR003657WRKY domain
PROSITE profilePS5081138.354409474IPR003657WRKY domain
SMARTSM007742.3E-37414473IPR003657WRKY domain
PfamPF031066.0E-25415472IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
MAMHLDHIFL MKLILLSLYA QPSPTTGTFP FPPLSQNSSE SVAAASDANR DEDIDDFDPS  60
SFVFKPHVDS VSVSFLQDAI NQASVDSNQA QPVAGSETHC QSQSHGQPQA ENEYQAAFVK  120
STLLSNSTSD PVPHPEAPNI RVEETNCISL QGGPPPGVPV EQVPEHHHQQ IVEDFGGQQI  180
FEGDSKAAFP ATMAGRPSED GYNWRKYGQK QVKGSEYPRS YYKCTHPNCQ VKKKVERSHD  240
GQITEIIYKG SHNHPKPQPN RRSAVGLGFP GSEFSDRPEQ AQGSLVKVEG GSVWRSFLGS  300
VKDKGGTEWR GDGLERTSSA SVVTDISDPS STAQAKQFCN LDSTDTPELS STLPSDDEDR  360
ATQGSVSHGD DADEEDSESK RRKKDSLLIE TNLGSRAVRE PRVVVQTTSE VDILDDGYRW  420
RKYGQKVVKG NPNPRSYYKC TNAGCSVRKH VERASHDVKS VITTYEGKHN HDVPAARNSG  480
AHASSSAPSN TGTATSSSPP QVQPLAPPIV PKPEPQPQDL VPRFGRAPEL SSNFMESHTL  540
PSLNGDIKLG VSTSYDMKLP PLQTMPLSTF GMGMAHGNVH HFGPTLPNIG PTPNFVGPFP  600
INMRRPQSVG HGFNGAKPMH VPMPMPMPMP MTMGSVQSYG MQPKETESRF LRPKEEPRGE  660
PMFEGRLPVG HGANGSPSVY HNHQNHNQTV GRFPL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-36199475878Probable WRKY transcription factor 4
2lex_A2e-36199475878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011621822.10.0PREDICTED: probable WRKY transcription factor 20
TrEMBLW1P1S60.0W1P1S6_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.18e-96WRKY DNA-binding protein 2
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]